PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011085622.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family M-type_MADS
Protein Properties Length: 246aa    MW: 27672.1 Da    PI: 4.4931
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011085622.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.12e-222169149
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    k+ie k+n qvtfskRr+g++ KA+ELSvLC+ae+a+++ s+ gk++ +
  XP_011085622.1 21 KKIEKKTNLQVTFSKRRTGLFRKASELSVLCGAEIAILVQSPAGKIFSF 69
                    68*******************************************9988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.01E-271383IPR002100Transcription factor, MADS-box
PROSITE profilePS5006627.6141373IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-331372IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-221535IPR002100Transcription factor, MADS-box
PfamPF003193.4E-232269IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-223550IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-225071IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MGSSGGNSSK KTMGRRKIEI KKIEKKTNLQ VTFSKRRTGL FRKASELSVL CGAEIAILVQ  60
SPAGKIFSFG NPSVESVLSR FQKGGSLPPP PPRNVGIGEN RIGEYAEEVK RLEGEKEMEK  120
SVKEKERELW WDEPVESMEL HELEEYAKAL EGLRDNVVHR VEEMEKQKLI IVDDNAFGSL  180
DLMDHDDTVE SSSNGGGFTA VEFNEEEFDG CWEGVRMEGY DHLLAEMDAT DECLSFLDVY  240
PSLWDT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-151381169Myocyte-specific enhancer factor 2B
1tqe_Q2e-151381169Myocyte-specific enhancer factor 2B
1tqe_R2e-151381169Myocyte-specific enhancer factor 2B
1tqe_S2e-151381169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0568722e-56KJ056872.1 Sesamum indicum clone TilSSR_28073 microsatellite Sesame_28073 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085622.10.0PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A022RIX04e-42A0A022RIX0_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13821415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.17e-31AGAMOUS-like 62